PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold09108-augustus-gene-0.9-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 520aa    MW: 57293.9 Da    PI: 5.9272
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold09108-augustus-gene-0.9-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-183986148
                                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                                  +g+WT  Ed +lv++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  maker-scaffold09108-augustus-gene-0.9-mRNA-1 39 KGPWTSAEDAILVEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 86
                                                  79******************************************9986 PP

2Myb_DNA-binding45.41.9e-1492135146
                                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                                   +g + +eE+ +++++++++G++ W++ a++++ gRt++++k++w++
  maker-scaffold09108-augustus-gene-0.9-mRNA-1  92 KGGFNPEEERRIIELHAMMGNK-WARMAAELP-GRTDNEIKNYWNT 135
                                                   57799*****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9543486IPR017930Myb domain
SuperFamilySSF466895.62E-3036133IPR009057Homeodomain-like
SMARTSM007176.1E-163888IPR001005SANT/Myb domain
PfamPF002495.2E-163986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-244093IPR009057Homeodomain-like
CDDcd001675.08E-124186No hitNo description
PROSITE profilePS5129423.70787141IPR017930Myb domain
SMARTSM007171.0E-1491139IPR001005SANT/Myb domain
PfamPF002492.1E-1392135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-2494139IPR009057Homeodomain-like
CDDcd001671.10E-1095135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MGATNDSEKR KISKGRRDLA SIQEACAGGS LGVGGGLKKG PWTSAEDAIL VEYVKKHGEG  60
NWNAVQKHSG LSRCGKSCRL RWANHLRPDL KKGGFNPEEE RRIIELHAMM GNKWARMAAE  120
LPGRTDNEIK NYWNTRIKRL QRAGAPIYPP EVCLQVLNGS QDNQKSTLPT GDAHHHDHLQ  180
GEDLEIPDVK FKDLDLDREC LSYSPKLLDI PASSLLKQGI CSSRPYNFKL PTIYPFKRFR  240
ESETMFPGLD VSVSGALPIF SHYMDNTYEN VAEPFNLPSI TFPYHNTNDQ LPSGVLPGSH  300
ALLNGNSSSS EPISEAMKLE LPSLQYSETQ PGSWGTPTSP LPSLESVDSL IQSPPTEQTH  360
SPRSSGLLEA ILYESQTLKG SKNSPQQTSD TSFMPADVVE SSPMNPCNKT KWEAHGEPNS  420
PLGHSAASVF SEYTPLSGSS MDEHQSVETV LGCSSMPETD SQDRTHYVIK KEISTQRDFT  480
RPDALLDLGW FGHINEHGKD QSTLTDAIGA LLGEEYSNGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31371395106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012075987.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067KE640.0A0A067KE64_JATCU; MYB family protein
STRINGGLYMA20G11040.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.12e-96myb domain protein 65